TB-500 (Thymosin Beta-4) (43 aa)

$65.00

Compound: TB500 (Thymosin β4) (43aa)
Molecular Formula: C212H350N56O78S
Molecular Weight: 4963.5 g/mol
CAS Number: 77591-33-4
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
PubChem CID: 16132341 (size: 10mg)

1000 in stock

🔥 Exclusive Crypto Offer

Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.

Don't have crypto? Buy it here in 5 minutes with easy guidance.

💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!

SKU: am-1785130888466-24 Category: