LL-37

$63.00

Compound: LL-37
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.3 g/mol
CAS Number: 154947-66-7
Sequence: [LL-37, 37 aa]
PubChem CID: 16129683 (size: 5mg)

1000 in stock

🔥 Exclusive Crypto Offer

Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.

âš¡ Don't have crypto? Buy it here in 5 minutes with easy guidance.

💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!

SKU: am-1785130875007-2 Category: